序列：Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40)；GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (Disulfide bridge: Cys33-Cys40)； S961 acetate is an high-affinity and selective insulin receptor ( IR ) antagonist with IC 50 s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively. Appearance:Solid In Vitro:S961 also shows high-affinity to Rat IR and Pig IR with IC 50 s of 0.056 nM and 0.084 nM in PEG-assay, respectively. MCE has not independently confirmed the accuracy of these methods. They are for reference only. Biological Activity:S961 acetate is an high-affinity and selective insulin receptor ( IR ) antagonist with IC 50 s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.
All
Chemical Reagents
Biomedicine
Organic raw materials
Inorganic chemical industry
intermediate
Agricultural chemicals
Auxiliaries and catalysts
Fragrances and Flavors
Dyes and Pigments
Daily chemical industry
S961 acetate
CAS number：1083433-49-1(free basis) molecular formula：C211H295N55O71S2(free basis)
overview
compound introduction
Specs
| Chinese alias | S961醋酸盐 | ||
| English alias | - | ||
| CAS number | 1083433-49-1(free basis) | molecular formula | C211H295N55O71S2(free basis) |
| molecular weight | 4802.12(free basis) | Exact mass | - |
| PSA | - | logp | - |
numbering system
No numbering system information yet
physicochemical properties
No physical and chemical property information yet
Safety information
No safety information yet
Production methods and uses
No production method and use information yet
Related
upstream information
No upstream information yet
downstream information
No downstream information yet
MSDS
Found 0 shareMSDS
