CAS number：unknown molecular formula：C213H342N58O66S2\n
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions. Appearance:Solid Biological Activity:NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
| Chinese alias | - | ||
| English alias | - | ||
| CAS number | unknown | molecular formula | C213H342N58O66S2\n |
| molecular weight | 4835.47 g/mol | Exact mass | ≥96% |
| PSA | - | logp | - |
No numbering system information yet
No physical and chemical property information yet
No safety information yet
No production method and use information yet
No upstream information yet
No downstream information yet
