compound introduction
序列：QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22) ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC 50 =0.27 nM; K d =0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle Appearance:Solid Biological Activity:ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC 50 =0.27 nM; K d =0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle
