CAS number：68563-24-6(free base) molecular formula：C167H257N47O46(free base)
Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH(1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity. Sequence (Three-Letter Code): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu Sequence(One-Letter Code): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
| Chinese alias | - | ||
| English alias | Adrenocorticotropic hormone 7-38, human | Adrenocorticotropic hormone 7-38, human | ACTH (7-38) (human) | Corticostatin | ||
| CAS number | 68563-24-6(free base) | molecular formula | C167H257N47O46(free base) |
| molecular weight | 3659.2 (free base) g | Exact mass | - |
| PSA | - | logp | - |
No numbering system information yet
No physical and chemical property information yet
No safety information yet
No production method and use information yet
No upstream information yet
No downstream information yet
