Warm reminder:
Because the manufacturer may temporarily adjust product specifications, prices, inventory, parameters and other information without notice, and there are differences in each user's consultation time and procurement needs, the platform reply content is only of reference value within a certain period. Sorry for the inconvenience caused to you, and thank you for your understanding and support! Please consult the online customer service for the latest details. Everything is subject to the real-time reply of the customer service.!
Please check the quantity, appearance and product information in time when you receive the goods. In case of damage, wrong delivery, abnormal quality and other problems, please feel free to contact us.
Service Hotline:400-6226-992 ,We will handle it for you as soon as possible, thank you for your support and trust.!
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96% 1mg
Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD) 96% 1mg CAS 317366-82-8, complete specifications for production, research, laboratory testing and inspection; digital one-stop procurement platform for scientific materials.




